PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 276aa    MW: 30944.3 Da    PI: 6.6352
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11045genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-52191511129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...k 96 
               lppGfrFhPtdee+v++yL++k+++ ++++  +++ v+++++ePwdLpk  k+  +++ew+fF+++d+ky+tg+r+nratksgyWkatgkdke+++    +
  EMT11045  19 LPPGFRFHPTDEEVVTHYLTPKIRNPDFSC-LMVSYVNLNNTEPWDLPKkaKMGVGQSEWFFFVHKDRKYPTGTRTNRATKSGYWKATGKDKEIFRGtglG 118
               79*************************999.679*************95346666899*************************************987767 PP

       NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                 lvg+kktLvfy+grap g+kt Wvmheyrle
  EMT11045 119 AVLVGMKKTLVFYRGRAPGGQKTPWVMHEYRLE 151
               777****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5815174IPR003441NAC domain
PROSITE profilePS5100556.30819174IPR003441NAC domain
PfamPF023659.8E-2920150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MSDVTAVMHL RGEEPWLALP PGFRFHPTDE EVVTHYLTPK IRNPDFSCLM VSYVNLNNTE  60
PWDLPKKAKM GVGQSEWFFF VHKDRKYPTG TRTNRATKSG YWKATGKDKE IFRGTGLGAV  120
LVGMKKTLVF YRGRAPGGQK TPWVMHEYRL EGELPHRLPR SAKDDWAVCR LLNKDMAAKN  180
APQMAPAADA GMEEEDPFAF LDELLNSDDL LNNADLLDNA DPPMLMDSPS GAIDFAGASS  240
STSSVALPIG PYMEHLTRKT EPPAPQQQSP NYMWKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-471718018174NAC domain-containing protein 19
3swm_B1e-471718018174NAC domain-containing protein 19
3swm_C1e-471718018174NAC domain-containing protein 19
3swm_D1e-471718018174NAC domain-containing protein 19
3swp_A1e-471718018174NAC domain-containing protein 19
3swp_B1e-471718018174NAC domain-containing protein 19
3swp_C1e-471718018174NAC domain-containing protein 19
3swp_D1e-471718018174NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694971.12e-97PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLJ26e-73NC100_ARATH; NAC domain-containing protein 100
TrEMBLM8BBK40.0M8BBK4_AEGTA; Protein CUP-SHAPED COTYLEDON 3
STRINGMLOC_65714.11e-138(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.17e-73Arabidopsis NAC domain containing protein 87